PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013620810.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family NAC
Protein Properties Length: 524aa    MW: 58272 Da    PI: 4.4622
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013620810.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1683.1e-5291361128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 
                     l+pGfrFhPtdeelv +yLk+kv +k++++ ++i+ +d+yk+ePwdLp k k+k+++ ewyfFs  dkky++g+++nrat++gyWk+tgkd+e+ 
  XP_013620810.1   9 LAPGFRFHPTDEELVRYYLKRKVCNKPFNF-DAISVADVYKSEPWDLPdKsKLKGRDLEWYFFSMLDKKYSNGSKTNRATERGYWKTTGKDREIR 102
                     579**************************9.99**************95346777777************************************* PP

             NAM  94 skkgelvglkktLvfykgrapkgektdWvmheyrl 128
                     + ++++vg+kktLv++kgrap+ge+++Wvmheyrl
  XP_013620810.1 103 N-GTRAVGMKKTLVYHKGRAPRGERSNWVMHEYRL 136
                     9.999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.45E-607159IPR003441NAC domain
PROSITE profilePS5100558.0189159IPR003441NAC domain
PfamPF023658.0E-2811136IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 524 aa     Download sequence    Send to blast
MGRGSATSLA PGFRFHPTDE ELVRYYLKRK VCNKPFNFDA ISVADVYKSE PWDLPDKSKL  60
KGRDLEWYFF SMLDKKYSNG SKTNRATERG YWKTTGKDRE IRNGTRAVGM KKTLVYHKGR  120
APRGERSNWV MHEYRLTDDE LKIAGAPQDA FVLCRVFQKC GTGDKYGAPC LEEEWEEDTM  180
TFVPEQEALC EGFGVDGDDV YLDIDEKPED LVVCDAIPVQ TNYCHGESSN NVESGNYEDC  240
GNYVVDSEQP IEEEELKPII RDGGIQPCSL FPGEQIGCGV EDEKAVNLET SNDNVFVAAD  300
TCYSGIPVDD ANYMPEEPFI NHSNNLSLSD GLSGAPLQDD FNFEDYLNFF DDEDAQNLSL  360
DVSQLLGSGE GLDQKQPSPE ELEKEKKSGE GSSSKQDADV IDLDSASKHP FLKKGSHMFA  420
PPSFASSQFQ TKDAAIRLHA AQSSGSVHVT AGMMRISNMT TLAAESSMGW SYDKNGNLNV  480
VLSLGLVQSK TGRITATRAM LIFMCFWILL LYVSFKIGTI VSAR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-44816516171NO APICAL MERISTEM PROTEIN
1ut4_B2e-44816516171NO APICAL MERISTEM PROTEIN
1ut7_A2e-44816516171NO APICAL MERISTEM PROTEIN
1ut7_B2e-44816516171NO APICAL MERISTEM PROTEIN
4dul_A2e-44816516171NAC domain-containing protein 19
4dul_B2e-44816516171NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKP6413560.0KP641356.1 Brassica napus NAC transcription factor 78.1 (NAC78.1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013620810.10.0PREDICTED: NAC domain-containing protein 78-like isoform X1
SwissprotQ84K000.0NAC78_ARATH; NAC domain-containing protein 78
TrEMBLA0A078FMJ20.0A0A078FMJ2_BRANA; BnaC02g02740D protein
STRINGBra028790.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM31922762
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G04410.10.0NAC domain containing protein 2